PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g076960.1
Common NameMTR_5g076960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 421aa    MW: 47073.7 Da    PI: 6.5656
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g076960.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-164387147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
  Medtr5g076960.1 43 REKWTDEEHKKFLEALKLYGRA-WRKIEEHVG-TKTAVQIRSHAQKF 87
                     789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.13E-173793IPR009057Homeodomain-like
PROSITE profilePS5129420.1493892IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-94091IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-164190IPR006447Myb domain, plants
SMARTSM007172.5E-134290IPR001005SANT/Myb domain
PfamPF002494.7E-144386IPR001005SANT/Myb domain
CDDcd001673.13E-104588No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MEILGQKEGM HSVIHVQKLL DQFSCGNDHA LKARKPYTIT KQREKWTDEE HKKFLEALKL  60
YGRAWRKIEE HVGTKTAVQI RSHAQKFFSK INRDTDGNDT TMVETIEIPP PRPKRKPIHP  120
YPRKLVEIPK NEISNLEQPL RSNSLVSLDF GQENNSPKSV LSAVASETLG FSDSDTPAGS  180
LSPVSSISAV HTSRFPLLES KSSSSEEDLS QQIDELNGGS THDVQPLMKL ELFPKECVAT  240
NEVAAEESPC RTLKLFGTTL LVKDTCKSSL TSTDASEPIP ATQQLQRGCS DISLATVVPW  300
WTISDNSAFK PLHTEPEGKH LHSNHGECED KEIQKEGSSC VGSNSTSSIS DEESNERLDD  360
QAKSDNVNYF VGHTTLNETV RLRTFGKGFV PYKRCMAERE RQCSTVTDER REHQRMRLSL  420
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.133460.0flower| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1417010.0BT141701.1 Medicago truncatula clone JCVI-FLMt-19O16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616176.10.0myb transcription factor
TrEMBLG7KFU70.0G7KFU7_MEDTR; Myb transcription factor
STRINGGLYMA14G39130.11e-165(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29563372
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.12e-48MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]